Kommunicera med leverantören? Leverantör
Justina Ms. Justina
Vad kan jag göra för dig?
Chat Nu Kontakta leverantören

Dongguan Yalan Packing Materials Co., Ltd.

Genomskinligt vattentät anpassat paketband
Genomskinligt vattentät anpassat paketband
Genomskinligt vattentät anpassat paketband
Genomskinligt vattentät anpassat paketband
Genomskinligt vattentät anpassat paketband

Genomskinligt vattentät anpassat paketband

Betalning Typ: T/T
Incoterm: FOB
Min. Beställ: 1000 Piece/Pieces
Leverans Time: 15 dagar

Kontakta nu Lägg i varukorgen

Grundläggande information

    Size: 17-28 Inchs

    Color: Clear/Transparent

    Thickness: 40-80 Micron

    Length: 50-1000 Y

Additional Info

    Förpackning: kartong

    Produktivitet: 400 millions square meter/year

    Märke: Junxing

    Transportfordon: Ocean

    Hemorten: Kina

    Supply Förmåga: 30 millions square meters/month

    Certifikat: ISO/SGS

Produktbeskrivning

Genomskinligt vattentät anpassat paketband

Det transparenta paketbandet är gjord på basen av BOPP-filmen och efter högspänningskorona blir ytan riven och sedan belagd med lim och separeras sedan i små rullar, vilket är vår dagliga användning av parecl tape. Det kan vara mycket bra mycket bekvämt färdiga varor förpackningar i det dagliga livet, så nå rollen som skydd och fasta föremål, det finns många olika specifikationer, kan förpackas i enlighet med storleken på de objekt som behövs för att anpassa ditt eget band.

Produktbeskrivning

Funktioner:


1. Tunn tjocklek, super klar yta, låga kostnader hållbara

2. Inget gift, mer säkert

3. Lätt att använda, hög effektivitet

4. Hög motstånd, Draghållfasthet

5. Bättre förebygga skador och göra allmän förpackning så snygg


Specifikationer


Product

Thickness

Width(Yard)

Length(Yard)


Color


Core diameter


Packing QTY

BOPP saeling tape

33-80

4-72

20-1100

Transparent clear/Transparent Yellow

3"(76mm)

36/72/100roll/carton

Color packing Tape

33-80

4-72

20-1100

any color

3"(76mm)

36/72/100roll/carton

Printed tape

33-80

4-72

20-1100

any color

3"(76mm)

36/72/100roll/carton

Produktutställning

1


Img 8262

Img 8170




Packning och frakt


Certifikat

Utställning


FAQ

1: Hur styr ditt företag kvalitet?

A: Vi har implementerat ett strikt och komplett kvalitetsstyrningssystem, vilket säkerställer att varje produkt kan uppfylla kundernas kvalitetskrav.

Q2: Provfritt?

A: Ja, vi kan ge dig gratis prov när du behöver.

Q3: Kan du skriva ut privat logotyp / etikett på förpackningen?

A: Ja, din egen privata logotyp / etikett kan skrivas ut på förpackningen efter din juridiska auktorisation. Vi stöder OEM-service enligt våra kunders krav i många år.

F4: När kan jag få priset?

A: Vi brukar citera inom 24 timmar efter att ha fått din förfrågan om du är angelägen om att få priset. Ring oss eller berätta via e-post så att vi kommer att ta din förfrågan som prioritet.

F5: Är din fabrik direkt?

A: Ja, vi har vår egen fabrik. Alla våra produkter är konkurrenskraftiga och utmärkt kvalitet.

Q6: Har du ett speciellt pris och en tjänst för grossist?

A: Ja, vi kan erbjuda det bästa priset och tjänsterna för att möta våra kunders behov. Vi levererar OEM-service.

Q7: Vilka betalningsmetoder kan jag använda?

A: Vi accepterar T / T. Du kan betala via banköverföring och 30% deposition, 70% efter att du ser kopian av B / L.

Q8: Hur lång tid tar produktionen och leveransen av ordern?

A: Inom 10-15 dagar efter mottagandet av kassan.


Om oss:

Dongguan Yalan Packaging Materials Co, Ltd var född 2009, fabriken är belägen i Dongguan, täcker ett område på 18000 kvadratmeter, och är utrustad med avancerade tillverkningsmaskiner och inspektionsutrustning. Yalan tillhandahålla forskning och utveckling, tillverkning, försäljning och efter -försäljningstjänster inom förpackningsmaterialindustrin.

Skapat vårt eget varumärke [Yanlan ".Yanlan driver nu i nästan 50 länder och sysselsätter cirka 200 personer. Vi tilldelas ISO9001: 2008 kvalitetsstyrningssystemcertifiering under 2012.

Yanlan producerar och säljer 4 kategorier produkter:

1. PE stretch film serie produkter

2. BOPP band serie produkter

3. PP / PET-band serie produkter

4. Paketeringsmaskin




Kontakta oss







Produktkategorier : Tätningsband > Transparent tejp

E-posta denna leverantör

Ditt meddelande måste vara mellan 20-8000 tecken

Related Products List